TRIM58 monoclonal antibody (M02), clone 2H3
  • TRIM58 monoclonal antibody (M02), clone 2H3

TRIM58 monoclonal antibody (M02), clone 2H3

Ref: AB-H00025893-M02
TRIM58 monoclonal antibody (M02), clone 2H3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TRIM58.
Información adicional
Size 100 ug
Gene Name TRIM58
Gene Alias BIA2|DKFZp434C091
Gene Description tripartite motif-containing 58
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq HYWEVLVGEGAEWGLGVCQDTLPRKGETTPSPENGVWALWLLKGNEYMVLASPSVPLLQLESPRCIGIFLDYEAGEISFYNVTDGSYIYTFNQLFSGLLR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TRIM58 (NP_056246, 346 a.a. ~ 445 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 25893
Clone Number 2H3
Iso type IgG2a Kappa

Enviar uma mensagem


TRIM58 monoclonal antibody (M02), clone 2H3

TRIM58 monoclonal antibody (M02), clone 2H3