LETMD1 purified MaxPab mouse polyclonal antibody (B01P)
  • LETMD1 purified MaxPab mouse polyclonal antibody (B01P)

LETMD1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00025875-B01P
LETMD1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human LETMD1 protein.
Información adicional
Size 50 ug
Gene Name LETMD1
Gene Alias 1110019O13Rik|DKFZp586A011|HCCR-2|HCCR1
Gene Description LETM1 domain containing 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MALSRVCWARSAVWGSAVTPGHFVTRRLQLGRSGLAWGAPRSSKLHLSPKADVKNLMSYVVTKTKAINGKYHRFLGRHFPRFYVLYTIFMKGLQMLWADAKKARRIKTNMWKHNIKFHQLPYREMEHLRQFRQDVTKCLFLGIISIPPFANYLVFLLMYLFPRQLLIRHFWTPKQQTDFLDIYHAFRKQSHPEIISYLEKVIPLISDAGLRWRLTDLCTKIQRGTHPAIHDILALRECFSNHPLGMNQLQALHVK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen LETMD1 (NP_056231.3, 1 a.a. ~ 360 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 25875

Enviar uma mensagem


LETMD1 purified MaxPab mouse polyclonal antibody (B01P)

LETMD1 purified MaxPab mouse polyclonal antibody (B01P)