SUMF2 monoclonal antibody (M02), clone 4B3
  • SUMF2 monoclonal antibody (M02), clone 4B3

SUMF2 monoclonal antibody (M02), clone 4B3

Ref: AB-H00025870-M02
SUMF2 monoclonal antibody (M02), clone 4B3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SUMF2.
Información adicional
Size 100 ug
Gene Name SUMF2
Gene Alias DKFZp566I1024|DKFZp686I1024|DKFZp686L17160|DKFZp781L1035|MGC99485|pFGE
Gene Description sulfatase modifying factor 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq QATSMVQLQGGRFLMGTNSPDSRDGEGPVREATVKPFAIDIFPVTNKDFRDFVREKKYRTEAEMFGWSFVFEDFVSDELRNKATQPMKSVLWWLPVEKAF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SUMF2 (NP_056226, 26 a.a. ~ 125 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 25870
Clone Number 4B3
Iso type IgG2a Kappa

Enviar uma mensagem


SUMF2 monoclonal antibody (M02), clone 4B3

SUMF2 monoclonal antibody (M02), clone 4B3