SUMF2 polyclonal antibody (A01)
  • SUMF2 polyclonal antibody (A01)

SUMF2 polyclonal antibody (A01)

Ref: AB-H00025870-A01
SUMF2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SUMF2.
Información adicional
Size 50 uL
Gene Name SUMF2
Gene Alias DKFZp566I1024|DKFZp686I1024|DKFZp686L17160|DKFZp781L1035|MGC99485|pFGE
Gene Description sulfatase modifying factor 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq QATSMVQLQGGRFLMGTNSPDSRDGEGPVREATVKPFAIDIFPVTNKDFRDFVREKKYRTEAEMFGWSFVFEDFVSDELRNKATQPMKSVLWWLPVEKAF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SUMF2 (NP_056226, 26 a.a. ~ 125 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 25870

Enviar uma mensagem


SUMF2 polyclonal antibody (A01)

SUMF2 polyclonal antibody (A01)