PRKD2 monoclonal antibody (M01), clone 2E4
  • PRKD2 monoclonal antibody (M01), clone 2E4

PRKD2 monoclonal antibody (M01), clone 2E4

Ref: AB-H00025865-M01
PRKD2 monoclonal antibody (M01), clone 2E4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PRKD2.
Información adicional
Size 50 ug
Gene Name PRKD2
Gene Alias HSPC187|PKD2
Gene Description protein kinase D2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq MDESEDSGVIPGSHSENALHASEEEEGEGGKAQSSLGYIPLMRVVQSVRHTTRKSSTTLREGWVVHYSNKDTLRKRHYWRLDCKCITLFQNNTTNRYYKEIPLSEILTVE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PRKD2 (AAH25307, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 25865
Clone Number 2E4
Iso type IgG2b Kappa

Enviar uma mensagem


PRKD2 monoclonal antibody (M01), clone 2E4

PRKD2 monoclonal antibody (M01), clone 2E4