ARMC8 purified MaxPab rabbit polyclonal antibody (D01P)
  • ARMC8 purified MaxPab rabbit polyclonal antibody (D01P)

ARMC8 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00025852-D01P
ARMC8 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ARMC8 protein.
Información adicional
Size 100 ug
Gene Name ARMC8
Gene Alias HSPC056|MGC10058|MGC4880|S863-2
Gene Description armadillo repeat containing 8
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MEVTASSRHYVDRLFDPDPQKVLQGVIDMKNAVIGNNKQKANLIVLGAVPRLLYLLQQETSSTELKTECAVVLGSLAMGTENNVKSLLDCHIIPALLQGLLSPDLKFIEACLRCLRTIFTSPVTPEELLYTDATVIPHLMALLSRSRYTQEYICQIFSHCCKGPDHQTILFNHGAVQNIAHLLTSLSYKVRMQALKCFSVLAFENPQVSMTLVNVLVDGELLPQIFVKMLQRDKPIEMQLTSAKCLTYMCRAGAI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ARMC8 (NP_054873.2, 1 a.a. ~ 385 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 25852

Enviar uma mensagem


ARMC8 purified MaxPab rabbit polyclonal antibody (D01P)

ARMC8 purified MaxPab rabbit polyclonal antibody (D01P)