POU2F3 monoclonal antibody (M02), clone 6D1
  • POU2F3 monoclonal antibody (M02), clone 6D1

POU2F3 monoclonal antibody (M02), clone 6D1

Ref: AB-H00025833-M02
POU2F3 monoclonal antibody (M02), clone 6D1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant POU2F3.
Información adicional
Size 100 ug
Gene Name POU2F3
Gene Alias Epoc-1|FLJ40063|MGC126698|OCT11|PLA-1|Skn-1a
Gene Description POU class 2 homeobox 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MVNLESMHTDIKMSGDVADSTDARSTLSQVEPGNDRNGLDFNRQIKTEDLSDSLQQTLSHRPCHLSQGPAMMSGNQMSGLNASPCQDMASLHPLQQLVLVPGHLQSVSQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen POU2F3 (NP_055167, 1 a.a. ~ 109 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 25833
Clone Number 6D1
Iso type IgG2a Kappa

Enviar uma mensagem


POU2F3 monoclonal antibody (M02), clone 6D1

POU2F3 monoclonal antibody (M02), clone 6D1