POU2F3 polyclonal antibody (A01)
  • POU2F3 polyclonal antibody (A01)

POU2F3 polyclonal antibody (A01)

Ref: AB-H00025833-A01
POU2F3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant POU2F3.
Información adicional
Size 50 uL
Gene Name POU2F3
Gene Alias Epoc-1|FLJ40063|MGC126698|OCT11|PLA-1|Skn-1a
Gene Description POU class 2 homeobox 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MVNLESMHTDIKMSGDVADSTDARSTLSQVEPGNDRNGLDFNRQIKTEDLSDSLQQTLSHRPCHLSQGPAMMSGNQMSGLNASPCQDMASLHPLQQLVLVPGHLQSVSQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen POU2F3 (NP_055167, 1 a.a. ~ 109 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 25833

Enviar uma mensagem


POU2F3 polyclonal antibody (A01)

POU2F3 polyclonal antibody (A01)