PRDX5 monoclonal antibody (M01), clone 3E6
  • PRDX5 monoclonal antibody (M01), clone 3E6

PRDX5 monoclonal antibody (M01), clone 3E6

Ref: AB-H00025824-M01
PRDX5 monoclonal antibody (M01), clone 3E6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PRDX5.
Información adicional
Size 100 ug
Gene Name PRDX5
Gene Alias ACR1|AOEB166|B166|MGC117264|MGC142283|MGC142285|PLP|PMP20|PRDX6|PRXV|SBBI10
Gene Description peroxiredoxin 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq LPGFVEQAEALKAKGVQVVACLSVNDAFVTGEWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNIISQL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PRDX5 (NP_036226, 105 a.a. ~ 214 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 25824
Clone Number 3E6
Iso type IgG2a Kappa

Enviar uma mensagem


PRDX5 monoclonal antibody (M01), clone 3E6

PRDX5 monoclonal antibody (M01), clone 3E6