PRDX5 MaxPab rabbit polyclonal antibody (D01)
  • PRDX5 MaxPab rabbit polyclonal antibody (D01)

PRDX5 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00025824-D01
PRDX5 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PRDX5 protein.
Información adicional
Size 100 uL
Gene Name PRDX5
Gene Alias ACR1|AOEB166|B166|MGC117264|MGC142283|MGC142285|PLP|PMP20|PRDX6|PRXV|SBBI10
Gene Description peroxiredoxin 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IP
Immunogen Prot. Seq MGLAGVCALRRSAGYILVGGAGGQSAAAAARRCSEGEWASGGVRSFSRAAAAMAPIKVGDAIPAVEVFEGEPGNKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVVACLSVNDAFVTGEWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNIISQL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PRDX5 (NP_036226.1, 1 a.a. ~ 214 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 25824

Enviar uma mensagem


PRDX5 MaxPab rabbit polyclonal antibody (D01)

PRDX5 MaxPab rabbit polyclonal antibody (D01)