KLK5 monoclonal antibody (M01), clone 3H3
  • KLK5 monoclonal antibody (M01), clone 3H3

KLK5 monoclonal antibody (M01), clone 3H3

Ref: AB-H00025818-M01
KLK5 monoclonal antibody (M01), clone 3H3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant KLK5.
Información adicional
Size 100 ug
Gene Name KLK5
Gene Alias KLK-L2|KLKL2|SCTE
Gene Description kallikrein-related peptidase 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq KSPQVHFPKVLQCLNISVLSQKRCEDAYPRQIDDTMFCAGDKAGRDSCQGDSGGPVVCNGSLQGLVSWGDYPCARPNRPGVYTNLCKFTKWIQETIQANS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen KLK5 (NP_036559, 194 a.a. ~ 293 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 25818
Clone Number 3H3
Iso type IgG2a Kappa

Enviar uma mensagem


KLK5 monoclonal antibody (M01), clone 3H3

KLK5 monoclonal antibody (M01), clone 3H3