LSM4 monoclonal antibody (M01), clone 8A10
  • LSM4 monoclonal antibody (M01), clone 8A10

LSM4 monoclonal antibody (M01), clone 8A10

Ref: AB-H00025804-M01
LSM4 monoclonal antibody (M01), clone 8A10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant LSM4.
Información adicional
Size 100 ug
Gene Name LSM4
Gene Alias YER112W
Gene Description LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MLPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGSTIKYLRIPD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LSM4 (NP_036453.1, 1 a.a. ~ 73 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 25804
Clone Number 8A10
Iso type IgG2a Kappa

Enviar uma mensagem


LSM4 monoclonal antibody (M01), clone 8A10

LSM4 monoclonal antibody (M01), clone 8A10