SPDEF monoclonal antibody (M01), clone 4A5
  • SPDEF monoclonal antibody (M01), clone 4A5

SPDEF monoclonal antibody (M01), clone 4A5

Ref: AB-H00025803-M01
SPDEF monoclonal antibody (M01), clone 4A5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SPDEF.
Información adicional
Size 100 ug
Gene Name SPDEF
Gene Alias PDEF|RP11-375E1__A.3|bA375E1.3
Gene Description SAM pointed domain containing ets transcription factor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq QCPVIDSQAPAGSLDLVPGGLTLEEHSLEQVQSMVVGEVLKDIETACKLLNITADPMDWSPSNVQKWLLWTEHQYRLPPMGKAFQELAGKELCAMSEEQFRQRSPLGGD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SPDEF (NP_036523, 92 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 25803
Clone Number 4A5
Iso type IgG2b Kappa

Enviar uma mensagem


SPDEF monoclonal antibody (M01), clone 4A5

SPDEF monoclonal antibody (M01), clone 4A5