ZNF324 purified MaxPab mouse polyclonal antibody (B01P)
  • ZNF324 purified MaxPab mouse polyclonal antibody (B01P)

ZNF324 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00025799-B01P
ZNF324 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ZNF324 protein.
Información adicional
Size 50 ug
Gene Name ZNF324
Gene Alias ZF5128|ZNF324A
Gene Description zinc finger protein 324
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAFEDVAVYFSQEEWGLLDTAQRALYRRVMLDNFALVASLGLSTSRPRVVIQLERGEEPWVPSGTDTTLSRTTYRRRNPGSWSLTEDRDVSGEWPRAFPDTPPGMTTSVFPVAGACHSVKSLQRQRGASPSRERKPTGVSVIYWERLLLGSGSGQASVSLRLTSPLRPPEGVRLREKTLTEHALLGRQPRTPERQKPCAQEVPGRTFGSAQDLEAAGGRGHHRMGAVWQEPHRLLGGQEPSTWDELGEALHAGEK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ZNF324 (AAH07717.1, 1 a.a. ~ 286 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 25799

Enviar uma mensagem


ZNF324 purified MaxPab mouse polyclonal antibody (B01P)

ZNF324 purified MaxPab mouse polyclonal antibody (B01P)