QPCT purified MaxPab mouse polyclonal antibody (B01P)
  • QPCT purified MaxPab mouse polyclonal antibody (B01P)

QPCT purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00025797-B01P
QPCT purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human QPCT protein.
Información adicional
Size 50 ug
Gene Name QPCT
Gene Alias GCT|QC
Gene Description glutaminyl-peptide cyclotransferase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen QPCT (NP_036545.1, 1 a.a. ~ 361 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 25797

Enviar uma mensagem


QPCT purified MaxPab mouse polyclonal antibody (B01P)

QPCT purified MaxPab mouse polyclonal antibody (B01P)