RASGRP3 purified MaxPab rabbit polyclonal antibody (D01P)
  • RASGRP3 purified MaxPab rabbit polyclonal antibody (D01P)

RASGRP3 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00025780-D01P
RASGRP3 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human RASGRP3 protein.
Información adicional
Size 100 ug
Gene Name RASGRP3
Gene Alias GRP3|KIAA0846
Gene Description RAS guanyl releasing protein 3 (calcium and DAG-regulated)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IF
Immunogen Prot. Seq MGSSGLGKAATLDELLCTCIEMFDDNGELDNSYLPRIVLLMHRWYLSSTELAEKLLCMYRNATGESCNEFRLKICYFMRYWILKFPAEFNLDLGLIRMTEEFREVASQLGYEKHVSLIDISSIPSYDWMRRVTQRKKVSKKGKACLLFDHLEPIELAEHLTFLEHKSFRRISFTDYQSYVIHGCLENNPTLERSIALFNGISKWVQLMVLSKPTPQQRAEVITKFINVAKKLLQLKNFNTLMAVVGGLSHSSISR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RASGRP3 (NP_733772.1, 1 a.a. ~ 690 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 25780

Enviar uma mensagem


RASGRP3 purified MaxPab rabbit polyclonal antibody (D01P)

RASGRP3 purified MaxPab rabbit polyclonal antibody (D01P)