DSTYK monoclonal antibody (M08), clone 4D5
  • DSTYK monoclonal antibody (M08), clone 4D5

DSTYK monoclonal antibody (M08), clone 4D5

Ref: AB-H00025778-M08
DSTYK monoclonal antibody (M08), clone 4D5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant DSTYK.
Información adicional
Size 100 ug
Gene Name DSTYK
Gene Alias DustyPK|HDCMD38P|KIAA0472|RIP5|RIPK5
Gene Description dual serine/threonine and tyrosine protein kinase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq DVAETGLQAGQLSCISFPPKEEKYLQQIVDCLPCILILGQDCNVKCQLLNLLLGVQVLPTTKLGSEESCKLRRLRFTYGTQTRVSLALPGQYELVHTLVAHQGNWETIPE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DSTYK (NP_056190, 80 a.a. ~ 189 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 25778
Clone Number 4D5
Iso type IgG2b Kappa

Enviar uma mensagem


DSTYK monoclonal antibody (M08), clone 4D5

DSTYK monoclonal antibody (M08), clone 4D5