FTSJ1 MaxPab mouse polyclonal antibody (B01)
  • FTSJ1 MaxPab mouse polyclonal antibody (B01)

FTSJ1 MaxPab mouse polyclonal antibody (B01)

Ref: AB-H00024140-B01
FTSJ1 MaxPab mouse polyclonal antibody (B01)

Información del producto

Mouse polyclonal antibody raised against a full-length human FTSJ1 protein.
Información adicional
Size 50 uL
Gene Name FTSJ1
Gene Alias CDLIV|JM23|MRX44|MRX9|SPB1|TRM7
Gene Description FtsJ homolog 1 (E. coli)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MGRTSKDKRDVYYRLAKENGWRARSAFKLLQLDKEFQLFQGVTRAVDLCAAPGSWSQVLSQKIGGQGSGHVVAVDLQAMAPLPGVVQIQGDITQLSTAKEIIQHFKGCPADLVVCDGAPDVTDLHDVDEYMQAQLLLAALNIATHVLKPGGCFVAKIFRGRDVTLLYSQLQVFFSSVLCAKPRSSRNSSIEAFAVCQGYDPPEGFIPDLSKPLLDHSYDPDFNQLDGPTRIIVPFVTCGDLSSYDSDRSYPLDLE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FTSJ1 (AAH23584, 1 a.a. ~ 329 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 24140

Enviar uma mensagem


FTSJ1 MaxPab mouse polyclonal antibody (B01)

FTSJ1 MaxPab mouse polyclonal antibody (B01)