APOL2 purified MaxPab mouse polyclonal antibody (B01P)
  • APOL2 purified MaxPab mouse polyclonal antibody (B01P)

APOL2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00023780-B01P
APOL2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human APOL2 protein.
Información adicional
Size 50 ug
Gene Name APOL2
Gene Alias APOL-II|APOL3
Gene Description apolipoprotein L, 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr
Immunogen Prot. Seq MNPESSIFIEDYLKYFQDQVSRENLLQLLTDDEAWNGFVAAAELPRDEADELRKALNKLASHMVMKDKNRHDKDQQHRQWFLKEFPRLKRELEDHIRKLRALAEEVEQVHRGTTIANVVSNSVGTTSGILTLLGLGLAPFTEGISFVLLDTGMGLGAAAAVAGITCSVVELVNKLRARAQARNLDQSGTNVAKVMKEFVGGNTPNVLTLVDNWYQVTQGIGRNIRAIRRARANPQLGAYAPPPHVIGRISAEGGE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen APOL2 (AAH04395.1, 1 a.a. ~ 337 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23780

Enviar uma mensagem


APOL2 purified MaxPab mouse polyclonal antibody (B01P)

APOL2 purified MaxPab mouse polyclonal antibody (B01P)