BHMT2 monoclonal antibody (M02A), clone 1E8
  • BHMT2 monoclonal antibody (M02A), clone 1E8

BHMT2 monoclonal antibody (M02A), clone 1E8

Ref: AB-H00023743-M02A
BHMT2 monoclonal antibody (M02A), clone 1E8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant BHMT2.
Información adicional
Size 200 uL
Gene Name BHMT2
Gene Alias FLJ20001
Gene Description betaine-homocysteine methyltransferase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MAPAGRPGAKKGILERLESGEVVIGDGSFLITLEKRGYVKAGLWTPEAVIEHPDAVRQLHMEFLRAGSNVMQTFTFSASEDNMESKWEDVNAAACDLAREVAGKGDALVA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen BHMT2 (NP_060084, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 23743
Clone Number 1E8
Iso type IgM Kappa

Enviar uma mensagem


BHMT2 monoclonal antibody (M02A), clone 1E8

BHMT2 monoclonal antibody (M02A), clone 1E8