C9orf4 polyclonal antibody (A01)
  • C9orf4 polyclonal antibody (A01)

C9orf4 polyclonal antibody (A01)

Ref: AB-H00023732-A01
C9orf4 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant C9orf4.
Información adicional
Size 50 uL
Gene Name C9orf4
Gene Alias CG-6|CG6
Gene Description chromosome 9 open reading frame 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq FRYGKPGCNAETCDYFLSYRMIGADVEFELSADTDGWVAVGFSSDKKMGGDDVMACVHDDNGRVRIQHFYNVGQWAKEIQRNPARDEEGVFENNRVTCRFKRPVNVPRDE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen C9orf4 (NP_055149, 158 a.a. ~ 267 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 23732

Enviar uma mensagem


C9orf4 polyclonal antibody (A01)

C9orf4 polyclonal antibody (A01)