CADM1 purified MaxPab rabbit polyclonal antibody (D01P)
  • CADM1 purified MaxPab rabbit polyclonal antibody (D01P)

CADM1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00023705-D01P
CADM1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CADM1 protein.
Información adicional
Size 100 ug
Gene Name CADM1
Gene Alias BL2|DKFZp686F1789|IGSF4|IGSF4A|MGC149785|MGC51880|NECL2|Necl-2|RA175|ST17|SYNCAM|TSLC1|sTSLC-1|sgIGSF|synCAM1
Gene Description cell adhesion molecule 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MASVVLPSGSQCAAAAAAAAPPGLRLRLLLLLFSAAALIPTGDGQNLFTKDVTVIEGEVATISCQVNKSDDSVIQLLNPNRQTIYFRDFRPLKDSRFQLLNFSSSELKVSLTNVSISDEGRYFCQLYTDPPQESYTTITVLVPPRNLMIDIQKDTAVEGEEIEVNCTAMASKPATTIRWFKGNTELKGKSEVEEWSDMYTVTSQLMLKVHKEDDGVPVICQVEHPAVTGNLQTQRYLEVQYKPQVHIQMTYPLQG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CADM1 (AAH47021.1, 1 a.a. ~ 387 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23705

Enviar uma mensagem


CADM1 purified MaxPab rabbit polyclonal antibody (D01P)

CADM1 purified MaxPab rabbit polyclonal antibody (D01P)