SH3BP4 polyclonal antibody (A01)
  • SH3BP4 polyclonal antibody (A01)

SH3BP4 polyclonal antibody (A01)

Ref: AB-H00023677-A01
SH3BP4 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SH3BP4.
Información adicional
Size 50 uL
Gene Name SH3BP4
Gene Alias BOG25|TTP
Gene Description SH3-domain binding protein 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MAAQRIRAANSNGLPRCKSEGTLIDLSEGFSETSFNDIKVPSPSALLVDNPTPFGNAKEVIAIKDYCPTNFTTLKFSKGDHLYVLDTSGGEWWYAHNTTEMGYIPSSYVQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SH3BP4 (AAH57396, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 23677

Enviar uma mensagem


SH3BP4 polyclonal antibody (A01)

SH3BP4 polyclonal antibody (A01)