SSBP3 polyclonal antibody (A01)
  • SSBP3 polyclonal antibody (A01)

SSBP3 polyclonal antibody (A01)

Ref: AB-H00023648-A01
SSBP3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SSBP3.
Información adicional
Size 50 uL
Gene Name SSBP3
Gene Alias CSDP|FLJ10355|SSDP|SSDP1
Gene Description single stranded DNA binding protein 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MFAKGKGSAVPSDGQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLYCAAPERRDTCEHSSEAKAFHDYSAAAAPSPVL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SSBP3 (NP_060540, 1 a.a. ~ 102 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 23648

Enviar uma mensagem


SSBP3 polyclonal antibody (A01)

SSBP3 polyclonal antibody (A01)