EDC4 monoclonal antibody (M01), clone 2E2
  • EDC4 monoclonal antibody (M01), clone 2E2

EDC4 monoclonal antibody (M01), clone 2E2

Ref: AB-H00023644-M01
EDC4 monoclonal antibody (M01), clone 2E2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant EDC4.
Información adicional
Size 100 ug
Gene Name EDC4
Gene Alias Ge-1|HEDLS|RCD-8
Gene Description enhancer of mRNA decapping 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq PAQVFGQPPCPLSQPVLLSLIQQLASDLGTRTDLKLSYLEEAVMHLDHSDPITRDHMGSVMAQVRQKLFQFLQAEPHNSLGKAARRLSLMLHGLVTPSLP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EDC4 (NP_055144.3, 1302 a.a. ~ 1401 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23644
Clone Number 2E2
Iso type IgG2a Kappa

Enviar uma mensagem


EDC4 monoclonal antibody (M01), clone 2E2

EDC4 monoclonal antibody (M01), clone 2E2