LDOC1 purified MaxPab mouse polyclonal antibody (B01P)
  • LDOC1 purified MaxPab mouse polyclonal antibody (B01P)

LDOC1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00023641-B01P
LDOC1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human LDOC1 protein.
Información adicional
Size 50 ug
Gene Name LDOC1
Gene Alias BCUR1|Mar7|Mart7
Gene Description leucine zipper, down-regulated in cancer 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MVDELVLLLHALLMRHRALSIENSQLMEQLRLLVCERASLLRQVRPPSCPVPFPETFNGESSRLPEFIVQTASYMLVNENRFCNDAMKVAFLISLLTGEAEEWVVPYIEMDSPILGDYRAFLDEMKQCFGWDDDEDDDDEEEEDDY
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen LDOC1 (NP_036449.1, 1 a.a. ~ 146 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23641

Enviar uma mensagem


LDOC1 purified MaxPab mouse polyclonal antibody (B01P)

LDOC1 purified MaxPab mouse polyclonal antibody (B01P)