LDOC1 polyclonal antibody (A01)
  • LDOC1 polyclonal antibody (A01)

LDOC1 polyclonal antibody (A01)

Ref: AB-H00023641-A01
LDOC1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant LDOC1.
Información adicional
Size 50 uL
Gene Name LDOC1
Gene Alias BCUR1|Mar7|Mart7
Gene Description leucine zipper, down-regulated in cancer 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq LSIENSQLMEQLRLLVCERASLLRQVRPPSCPVPFPETFNGESSRLPEFIVQTASYMLVNENRFCNDAMKVAFLISLLTGEAEEWVVPYIEMDSPILGDYRA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LDOC1 (NP_036449, 19 a.a. ~ 120 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 23641

Enviar uma mensagem


LDOC1 polyclonal antibody (A01)

LDOC1 polyclonal antibody (A01)