HSPBP1 purified MaxPab rabbit polyclonal antibody (D01P)
  • HSPBP1 purified MaxPab rabbit polyclonal antibody (D01P)

HSPBP1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00023640-D01P
HSPBP1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human HSPBP1 protein.
Información adicional
Size 100 ug
Gene Name HSPBP1
Gene Alias FES1
Gene Description HSPA (heat shock 70kDa) binding protein, cytoplasmic cochaperone 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSDEGSRGSRLPLALPPASQGCSSGGGGGGSSAGGSGNSRPPRNLQGLLQMAITAGSEEPDPPPEPMSEERRQWLQEAMSAAFRGQREEVEQMKSCLRVLSQPMPPTAGEAEQAADQQEREGALELLADLCENMDNAADFCQLSGMHLLVGRYLEAGAAGLRWRAAQLIGTCSQNVAAIQEQVLGLGALRKLLRLLDRDACDTVRVKALFAISCLVREQEAGLLQFLRLDGFSVLMRAMQQQVQKLKVKSAFLLQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HSPBP1 (NP_036399.3, 1 a.a. ~ 359 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23640

Enviar uma mensagem


HSPBP1 purified MaxPab rabbit polyclonal antibody (D01P)

HSPBP1 purified MaxPab rabbit polyclonal antibody (D01P)