RABGAP1 monoclonal antibody (M06), clone 3D11
  • RABGAP1 monoclonal antibody (M06), clone 3D11

RABGAP1 monoclonal antibody (M06), clone 3D11

Ref: AB-H00023637-M06
RABGAP1 monoclonal antibody (M06), clone 3D11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RABGAP1.
Información adicional
Size 100 ug
Gene Name RABGAP1
Gene Alias DKFZp586D2123|GAPCENA|RP11-123N4.2|TBC1D11
Gene Description RAB GTPase activating protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MDDQPGEKELVKRSQLDGEGDGPLSNQLSASSTINPVPLVGLQKPEMSLPVKPGQGDSEASSPFTPVADEDSVVFSKLTYLGCASVNAPRSEVEALRMMSILRSQCQISL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RABGAP1 (AAH54492, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23637
Clone Number 3D11
Iso type IgG2a Kappa

Enviar uma mensagem


RABGAP1 monoclonal antibody (M06), clone 3D11

RABGAP1 monoclonal antibody (M06), clone 3D11