SPO11 purified MaxPab rabbit polyclonal antibody (D01P)
  • SPO11 purified MaxPab rabbit polyclonal antibody (D01P)

SPO11 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00023626-D01P
SPO11 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SPO11 protein.
Información adicional
Size 100 ug
Gene Name SPO11
Gene Alias MGC39953
Gene Description SPO11 meiotic protein covalently bound to DSB homolog (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MAFAPMGPEASFFDVLDRHRESLLAALRRGGREPPTGGSRLASRFEDSVGLQMVSHCTTRKIKSDSPKSAQKFSLILKILSMIYKLVQSNTYATKRDIYYTDSQLFGNQTVVDNIINDISCMLKVSRRSLHILSTSKGLIAGNLRYIEEDGTKVNCTCGATAVAVPSNIQGIRNLVTDAKFVLIVEKDATFQRLLDDNFCNKLSPCIMITGKGVPDLNTRLLVKKLWDTFHVPVFTLVDADPHGIEIMCIYKYGS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SPO11 (NP_937998.1, 1 a.a. ~ 358 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23626

Enviar uma mensagem


SPO11 purified MaxPab rabbit polyclonal antibody (D01P)

SPO11 purified MaxPab rabbit polyclonal antibody (D01P)