SPO11 polyclonal antibody (A01)
  • SPO11 polyclonal antibody (A01)

SPO11 polyclonal antibody (A01)

Ref: AB-H00023626-A01
SPO11 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SPO11.
Información adicional
Size 50 uL
Gene Name SPO11
Gene Alias MGC39953
Gene Description SPO11 meiotic protein covalently bound to DSB homolog (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq YGSMSMSFEAHHLTVPAIRWLGLLPSDLKRLNVPKDSLIPLTKRDQMKLDSILRRPYVTCQPFWRKEMEIMADSKMKAEIQALTFLSSDYLSRVYLPNKLKFGGW
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SPO11 (NP_036576, 291 a.a. ~ 395 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 23626

Enviar uma mensagem


SPO11 polyclonal antibody (A01)

SPO11 polyclonal antibody (A01)