RUSC1 purified MaxPab mouse polyclonal antibody (B01P)
  • RUSC1 purified MaxPab mouse polyclonal antibody (B01P)

RUSC1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00023623-B01P
RUSC1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human RUSC1 protein.
Información adicional
Size 50 ug
Gene Name RUSC1
Gene Alias DKFZp761A1822|NESCA
Gene Description RUN and SH3 domain containing 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MAEAQSGTGQLQEQKKGLLIAVSVSVDKIISHFGAARNLVQKAQLGDSRLSPDVGHLVLTTLCPALHALVADGLKPFRKDLITGQRRSSPWSVVEASVKPGSSTRSLGTLYSQVSRLAPLSSSRSRFHAFILGLLNTKQLELWFSSLQEDAGLLSLLYLPTGFFSLARGGCPSLSTELLLLLQPLSVLTFHLDLLFEHHHHLPLGPPQAPAPPGPPPALQQTMQAMLHFGGRLAQSLRGTSKEAASDPSDSPNLP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RUSC1 (NP_055143.2, 1 a.a. ~ 433 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23623

Enviar uma mensagem


RUSC1 purified MaxPab mouse polyclonal antibody (B01P)

RUSC1 purified MaxPab mouse polyclonal antibody (B01P)