TSSK2 monoclonal antibody (M02), clone 1H2
  • TSSK2 monoclonal antibody (M02), clone 1H2

TSSK2 monoclonal antibody (M02), clone 1H2

Ref: AB-H00023617-M02
TSSK2 monoclonal antibody (M02), clone 1H2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TSSK2.
Información adicional
Size 50 ug
Gene Name TSSK2
Gene Alias DGS-G|FLJ38613|SPOGA2|STK22B
Gene Description testis-specific serine kinase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq EILSHSWLQPPKPKATSSASFKREGEGKYRAECKLDTKTDLRPDHRPDHKLGAKTQHRLLVVPENENRMEDRLAETSRAKDHHISGAEVGKAST
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TSSK2 (AAH37781, 265 a.a. ~ 358 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23617
Clone Number 1H2
Iso type IgG

Enviar uma mensagem


TSSK2 monoclonal antibody (M02), clone 1H2

TSSK2 monoclonal antibody (M02), clone 1H2