TSSK2 purified MaxPab rabbit polyclonal antibody (D01P)
  • TSSK2 purified MaxPab rabbit polyclonal antibody (D01P)

TSSK2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00023617-D01P
TSSK2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human TSSK2 protein.
Información adicional
Size 100 ug
Gene Name TSSK2
Gene Alias DGS-G|FLJ38613|SPOGA2|STK22B
Gene Description testis-specific serine kinase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MDDATVLRKKGYIVGINLGKGSYAKVKSAYSERLKFNVAVKIIDRKKTPTDFVERFLPREMDILATVNHGSIIKTYEIFETSDGRIYIIMELGVQGDLLEFIKCQGALHEDVARKMFRQLSSAVKYCHDLDIVHRDLKCENLLLDKDFNIKLSDFGFSKRCLRDSNGRIILSKTFCGSAAYAAPEVLQSIPYQPKVYDIWSLGVILYIMVCGSMPYDDSDIRKMLRIQKEHRVDFPRSKNLTCECKDLIYRMLQP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TSSK2 (NP_443732.2, 1 a.a. ~ 358 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23617

Enviar uma mensagem


TSSK2 purified MaxPab rabbit polyclonal antibody (D01P)

TSSK2 purified MaxPab rabbit polyclonal antibody (D01P)