ZMYND8 monoclonal antibody (M01), clone 5B12
  • ZMYND8 monoclonal antibody (M01), clone 5B12

ZMYND8 monoclonal antibody (M01), clone 5B12

Ref: AB-H00023613-M01
ZMYND8 monoclonal antibody (M01), clone 5B12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ZMYND8.
Información adicional
Size 100 ug
Gene Name ZMYND8
Gene Alias MGC31836|PRKCBP1|PRO2893|RACK7
Gene Description zinc finger, MYND-type containing 8
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq DEQKSKNEPEDTEDKEGCQMDKEPSAVKKKPKPTNPVEIKEELKSTSPASEKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDKLKGKDETDSPTVHL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ZMYND8 (NP_898869, 601 a.a. ~ 698 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23613
Clone Number 5B12
Iso type IgG1 Kappa

Enviar uma mensagem


ZMYND8 monoclonal antibody (M01), clone 5B12

ZMYND8 monoclonal antibody (M01), clone 5B12