CORO1C monoclonal antibody (M02), clone 1F7
  • CORO1C monoclonal antibody (M02), clone 1F7

CORO1C monoclonal antibody (M02), clone 1F7

Ref: AB-H00023603-M02
CORO1C monoclonal antibody (M02), clone 1F7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CORO1C.
Información adicional
Size 100 ug
Gene Name CORO1C
Gene Alias HCRNN4
Gene Description coronin, actin binding protein, 1C
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq EEWFEGKNADPILISLKHGYIPGKNRDLKVVKKNILDSKPTANKKCDLISIPKKTTDTASVQNEAKLDEILKEIKSIKDTICNQDERISKLEQQMAKIA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CORO1C (NP_055140, 375 a.a. ~ 473 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23603
Clone Number 1F7
Iso type IgG2a Kappa

Enviar uma mensagem


CORO1C monoclonal antibody (M02), clone 1F7

CORO1C monoclonal antibody (M02), clone 1F7