CORO1C polyclonal antibody (A01)
  • CORO1C polyclonal antibody (A01)

CORO1C polyclonal antibody (A01)

Ref: AB-H00023603-A01
CORO1C polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CORO1C.
Información adicional
Size 50 uL
Gene Name CORO1C
Gene Alias HCRNN4
Gene Description coronin, actin binding protein, 1C
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq EEWFEGKNADPILISLKHGYIPGKNRDLKVVKKNILDSKPTANKKCDLISIPKKTTDTASVQNEAKLDEILKEIKSIKDTICNQDERISKLEQQMAKIA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CORO1C (NP_055140, 375 a.a. ~ 473 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 23603

Enviar uma mensagem


CORO1C polyclonal antibody (A01)

CORO1C polyclonal antibody (A01)