AMACR monoclonal antibody (M02), clone 1D8
  • AMACR monoclonal antibody (M02), clone 1D8

AMACR monoclonal antibody (M02), clone 1D8

Ref: AB-H00023600-M02
AMACR monoclonal antibody (M02), clone 1D8

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant AMACR.
Información adicional
Size 100 ug
Gene Name AMACR
Gene Alias RACE
Gene Description alpha-methylacyl-CoA racemase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,S-ELISA,ELISA
Immunogen Prot. Seq MALQGISVMELSGLAPGPFCAMVLADFGARVVRVDRPGSRYDVSRLGRGKRSLVLDLKQPRGAAVLRRLCKRSDVLLEPFRRGVMEKLQLGPEILQRENPRLIYARLSGFGQSGSFCRLAGHDINYLALSGGRNSMFKFFSVENSEIESVGSTSRTEHVGWWSTFLYDLQDSRWGIHGCWSNRTPVLRAADQRTWTKV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen AMACR (AAH09471, 1 a.a. ~ 198 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23600
Clone Number 1D8
Iso type IgG2b Kappa

Enviar uma mensagem


AMACR monoclonal antibody (M02), clone 1D8

AMACR monoclonal antibody (M02), clone 1D8