AMACR polyclonal antibody (A01)
  • AMACR polyclonal antibody (A01)

AMACR polyclonal antibody (A01)

Ref: AB-H00023600-A01
AMACR polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant AMACR.
Información adicional
Size 50 uL
Gene Name AMACR
Gene Alias RACE
Gene Description alpha-methylacyl-CoA racemase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MALQGISVMELSGLAPGPFCAMVLADFGARVVRVDRPGSRYDVSRLGRGKRSLVLDLKQPRGAAVLRRLCKRSDVLLEPFRRGVMEKLQLGPEILQRENPRLIYARLSGFGQSGSFCRLAGHDINYLALSGGRNSMFKFFSVENSEIESVGSTSRTEHVGWWSTFLYDLQDSRWGIHGCWSNRTPVLRAADQRTWTKV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen AMACR (AAH09471, 1 a.a. ~ 198 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 23600

Enviar uma mensagem


AMACR polyclonal antibody (A01)

AMACR polyclonal antibody (A01)