PATZ1 monoclonal antibody (M01), clone 1B2
  • PATZ1 monoclonal antibody (M01), clone 1B2

PATZ1 monoclonal antibody (M01), clone 1B2

Ref: AB-H00023598-M01
PATZ1 monoclonal antibody (M01), clone 1B2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PATZ1.
Información adicional
Size 100 ug
Gene Name PATZ1
Gene Alias MAZR|PATZ|RIAZ|ZBTB19|ZNF278|ZSG|dJ400N23
Gene Description POZ (BTB) and AT hook containing zinc finger 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq PLTGKRGRGRPRKANLLDSMFGSPGGLREAGILPCGLCGKVFTDANRLRQHEAQHGVTSLQLGYIDLPPPRLGENGLPISEDPDGPRKRSRTRKQVACE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PATZ1 (NP_114440.1, 260 a.a. ~ 358 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23598
Clone Number 1B2
Iso type IgG2b Kappa

Enviar uma mensagem


PATZ1 monoclonal antibody (M01), clone 1B2

PATZ1 monoclonal antibody (M01), clone 1B2