ZNF278 purified MaxPab mouse polyclonal antibody (B01P)
  • ZNF278 purified MaxPab mouse polyclonal antibody (B01P)

ZNF278 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00023598-B01P
ZNF278 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ZNF278 protein.
Información adicional
Size 50 ug
Gene Name PATZ1
Gene Alias MAZR|PATZ|RIAZ|ZBTB19|ZNF278|ZSG|dJ400N23
Gene Description POZ (BTB) and AT hook containing zinc finger 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MERVNDASCGPSGCYTYQVSRHSTEMLHNLNQQRKNGGRFCDVLLRVGDESFPAHRAVLAACSEYFESVFSAQLGDGGAADGGPADVGGATAAPGGGAGGSRELEMHTISSKVFGDILDFAYTSRIVVRLESFPELMTAAKFLLMRSVIEICQEVIKQSNVQILVPPARADIMLFRPPGTSDLGFPLDMTNGAALAANSNGIAGSMQPEEEAARAAGAAIAGQASLPVLPGVDRLPMVAGPLSPQLLTSPFPSVA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ZNF278 (NP_114440.1, 1 a.a. ~ 537 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23598

Enviar uma mensagem


ZNF278 purified MaxPab mouse polyclonal antibody (B01P)

ZNF278 purified MaxPab mouse polyclonal antibody (B01P)