ACOT9 MaxPab mouse polyclonal antibody (B01P)
  • ACOT9 MaxPab mouse polyclonal antibody (B01P)

ACOT9 MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00023597-B01P
ACOT9 MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ACOT9 protein.
Información adicional
Size 50 ug
Gene Name ACOT9
Gene Alias ACATE2|CGI-16|MT-ACT48
Gene Description acyl-CoA thioesterase 9
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MRRAALRLCALGKGQLTPGRGLTQGPQNPKKQGIFHIHEVRDKLREIVGASTNWRDHVKAMEERKLLHSFLAKSQDGLPPRRMKDSYIEVLLPLGSEPELREKYLTVQNTVRFGRILEDLDSLGVLICYMHNKIHSAKMSPLSIVTALVDKIDMCKKSLSPEQDIKFSGHVSWVGKTSMEVKMQMFQLHGDEFCPVLDATFVMVARDSENKG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ACOT9 (AAH12573.1, 1 a.a. ~ 212 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23597

Enviar uma mensagem


ACOT9 MaxPab mouse polyclonal antibody (B01P)

ACOT9 MaxPab mouse polyclonal antibody (B01P)