SMUG1 purified MaxPab mouse polyclonal antibody (B01P)
  • SMUG1 purified MaxPab mouse polyclonal antibody (B01P)

SMUG1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00023583-B01P
SMUG1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SMUG1 protein.
Información adicional
Size 50 ug
Gene Name SMUG1
Gene Alias FDG|HMUDG|MGC104370|UNG3
Gene Description single-strand-selective monofunctional uracil-DNA glycosylase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MPQAFLLGSIHEPAGALMEPQPCPGSLAESFLEEELRLNAELSQLQFSEPVGIIYNPVEYAWEPHRNYVTRYCQGPKEVLFLGMNPGPFGMAQTGVPFGEVSMVRDWLGIVGPVLTPPQEHPKRPVLGLECPQSEGPRQSMGHEIKSELLMGGCSWIRGKIQCDRVQVRRPGFSSQL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SMUG1 (AAH00417.1, 1 a.a. ~ 177 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23583

Enviar uma mensagem


SMUG1 purified MaxPab mouse polyclonal antibody (B01P)

SMUG1 purified MaxPab mouse polyclonal antibody (B01P)