SMUG1 polyclonal antibody (A01)
  • SMUG1 polyclonal antibody (A01)

SMUG1 polyclonal antibody (A01)

Ref: AB-H00023583-A01
SMUG1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SMUG1.
Información adicional
Size 50 uL
Gene Name SMUG1
Gene Alias FDG|HMUDG|MGC104370|UNG3
Gene Description single-strand-selective monofunctional uracil-DNA glycosylase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq PQAFLLGSIHEPAGALMEPQPCPGSLAESFLEEELRLNAELSQLQFSEPVGIIYNPVEYAWEPHRNYVTRYCQGPKE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SMUG1 (NP_055126, 2 a.a. ~ 78 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 23583

Enviar uma mensagem


SMUG1 polyclonal antibody (A01)

SMUG1 polyclonal antibody (A01)