CCNDBP1 monoclonal antibody (M02), clone 3B7 View larger

Mouse monoclonal antibody raised against a partial recombinant CCNDBP1.

AB-H00023582-M02

New product

CCNDBP1 monoclonal antibody (M02), clone 3B7

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name CCNDBP1
Gene Alias DIP1|GCIP
Gene Description cyclin D-type binding-protein 1
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq LVAENGKKDQVAQMADIVDISDEISPSVDDLALSIYPPMCHLTVRINSAKLVSVLKKALEITKASHVTPQPEDSWIPLLINAIDHCMNRIKELTQSELEL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CCNDBP1 (NP_036274.2, 261 a.a. ~ 360 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23582
Clone Number 3B7
Iso type IgG2a Kappa

More info

Mouse monoclonal antibody raised against a partial recombinant CCNDBP1.

Enviar uma mensagem

Mouse monoclonal antibody raised against a partial recombinant CCNDBP1.

Mouse monoclonal antibody raised against a partial recombinant CCNDBP1.