CCNDBP1 monoclonal antibody (M02), clone 3B7
  • CCNDBP1 monoclonal antibody (M02), clone 3B7

CCNDBP1 monoclonal antibody (M02), clone 3B7

Ref: AB-H00023582-M02
CCNDBP1 monoclonal antibody (M02), clone 3B7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CCNDBP1.
Información adicional
Size 100 ug
Gene Name CCNDBP1
Gene Alias DIP1|GCIP
Gene Description cyclin D-type binding-protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq LVAENGKKDQVAQMADIVDISDEISPSVDDLALSIYPPMCHLTVRINSAKLVSVLKKALEITKASHVTPQPEDSWIPLLINAIDHCMNRIKELTQSELEL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CCNDBP1 (NP_036274.2, 261 a.a. ~ 360 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23582
Clone Number 3B7
Iso type IgG2a Kappa

Enviar uma mensagem


CCNDBP1 monoclonal antibody (M02), clone 3B7

CCNDBP1 monoclonal antibody (M02), clone 3B7