CHST5 monoclonal antibody (M05), clone 2E6
  • CHST5 monoclonal antibody (M05), clone 2E6

CHST5 monoclonal antibody (M05), clone 2E6

Ref: AB-H00023563-M05
CHST5 monoclonal antibody (M05), clone 2E6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CHST5.
Información adicional
Size 100 ug
Gene Name CHST5
Gene Alias FLJ22167|I-GlcNAc-6-ST|MGC74625
Gene Description carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq GSGIGKPIEAFHTSSRNARNVSQAWRHALPFTKILRVQEVCAGALQLLGYRPVYSADQQRDLTLDLVLPRGPDHFSWASPD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CHST5 (NP_036258.1, 310 a.a. ~ 390 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23563
Clone Number 2E6
Iso type IgG2b Kappa

Enviar uma mensagem


CHST5 monoclonal antibody (M05), clone 2E6

CHST5 monoclonal antibody (M05), clone 2E6