GTPBP4 purified MaxPab mouse polyclonal antibody (B01P)
  • GTPBP4 purified MaxPab mouse polyclonal antibody (B01P)

GTPBP4 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00023560-B01P
GTPBP4 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human GTPBP4 protein.
Información adicional
Size 50 ug
Gene Name GTPBP4
Gene Alias CRFG|FLJ10686|FLJ10690|FLJ39774|NGB|NOG1
Gene Description GTP binding protein 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MAHYNFKKITVVPSAKDFIDLTLSKTQRKTPTVIHKHYQIHRIRHFYMRKVKFTQQNYHDRLSQILTDFPKLDDIHPFYADLMNILYDKDHYKLALGQINIAKNLVDNVAKDYVRLMKYGDSLYRCKQLKRAALGRMCTVIKRQKQSLEYLEQVRQHLSRLPTIDPNTRTLLLCGYPNVGKSSFINKVTRADVDVQPYAFTTKSLFVGHMDYKYLRWQVVDTPGILDHPLEDRNTIEMQAITALAHLRAAVLYVM
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GTPBP4 (NP_036473.2, 1 a.a. ~ 634 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23560

Enviar uma mensagem


GTPBP4 purified MaxPab mouse polyclonal antibody (B01P)

GTPBP4 purified MaxPab mouse polyclonal antibody (B01P)