SNAPAP monoclonal antibody (M01), clone 3H1
  • SNAPAP monoclonal antibody (M01), clone 3H1

SNAPAP monoclonal antibody (M01), clone 3H1

Ref: AB-H00023557-M01
SNAPAP monoclonal antibody (M01), clone 3H1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SNAPAP.
Información adicional
Size 100 ug
Gene Name SNAPIN
Gene Alias SNAPAP
Gene Description SNAP-associated protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq DSHVHAVRESQVELREQIDNLATELCRINEDQKVALDLDPYVKKLLNARRRVVLVNNILQNAQERLRRLNHSVAKETARRRAMLDSGIYPPGSPGK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SNAPAP (NP_036569.1, 41 a.a. ~ 136 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23557
Clone Number 3H1
Iso type IgG1 Kappa

Enviar uma mensagem


SNAPAP monoclonal antibody (M01), clone 3H1

SNAPAP monoclonal antibody (M01), clone 3H1