SNAPAP polyclonal antibody (A01)
  • SNAPAP polyclonal antibody (A01)

SNAPAP polyclonal antibody (A01)

Ref: AB-H00023557-A01
SNAPAP polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SNAPAP.
Información adicional
Size 50 uL
Gene Name SNAPIN
Gene Alias SNAPAP
Gene Description SNAP-associated protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq DSHVHAVRESQVELREQIDNLATELCRINEDQKVALDLDPYVKKLLNARRRVVLVNNILQNAQERLRRLNHSVAKETARRRAMLDSGIYPPGSPGK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SNAPAP (NP_036569.1, 41 a.a. ~ 136 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 23557

Enviar uma mensagem


SNAPAP polyclonal antibody (A01)

SNAPAP polyclonal antibody (A01)