HYAL4 monoclonal antibody (M03), clone 1B10
  • HYAL4 monoclonal antibody (M03), clone 1B10

HYAL4 monoclonal antibody (M03), clone 1B10

Ref: AB-H00023553-M03
HYAL4 monoclonal antibody (M03), clone 1B10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant HYAL4.
Información adicional
Size 50 ug
Gene Name HYAL4
Gene Alias -
Gene Description hyaluronoglucosaminidase 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq FVSSDLGSYIANVTRAAEVCSLHLCRNNGRCIRKMWNAPSYLHLNPASYHIEASEDGEFTVKGKASDTDLAVMADTFSCHCYQGYEGADCREIKTADGCS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HYAL4 (NP_036401.1, 357 a.a. ~ 456 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23553
Clone Number 1B10
Iso type IgG2a Kappa

Enviar uma mensagem


HYAL4 monoclonal antibody (M03), clone 1B10

HYAL4 monoclonal antibody (M03), clone 1B10